4.95 Rating by CuteStat

It is a domain having de extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, kurort-zu-hause.de is SAFE to browse.

PageSpeed Score
98
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 757,000
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.31.85.83

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.31.85.83)

contagerencianet.com.br | 522: Connection timed out

- contagerencianet.com.br
Not Applicable $ 8.95


En Yeni Dekor Mobilya Modelleri

- dekormobilyam3.com

Mobilya Dekoratif modellerinin en iyileri

Not Applicable $ 8.95

News Travel Blog -

- utssa.com
Not Applicable $ 8.95

Wrinkle Miracle - Discover a $5 Solution to a Wrinkle Free Face

- skinimpracticalsympathy.review
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Tue, 10 Dec 2019 15:07:48 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 07 May 2019 12:39:07 GMT
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 54302168efe52832-SJC
Content-Encoding: gzip

Domain Nameserver Information

Host IP Address Country
jeff.ns.cloudflare.com 172.64.33.124 United States of America United States of America
laura.ns.cloudflare.com 173.245.58.183 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
kurort-zu-hause.de A 299 IP: 104.31.85.83
kurort-zu-hause.de A 299 IP: 104.31.84.83
kurort-zu-hause.de NS 86400 Target: laura.ns.cloudflare.com
kurort-zu-hause.de NS 86400 Target: jeff.ns.cloudflare.com
kurort-zu-hause.de SOA 3600 MNAME: jeff.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2031164723
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
kurort-zu-hause.de TXT 300 TXT: ca3-945ecbf6305f495d930852a58b211ab2
kurort-zu-hause.de AAAA 299 IPV6: 2606:4700:30::681f:5453
kurort-zu-hause.de AAAA 299 IPV6: 2606:4700:30::681f:5553

Full WHOIS Lookup

% Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: kurort-zu-hause.de
Nserver: jeff.ns.cloudflare.com
Nserver: laura.ns.cloudflare.com
Status: connect
Changed: 2019-12-09T16:15:17+01:00