Web Analysis for Kurort-Zu-Hause - kurort-zu-hause.de
4.95
Rating by CuteStat
It is a domain having de extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, kurort-zu-hause.de is SAFE to browse.
PageSpeed Score
98
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 757,000 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 104.31.85.83)
New England Bears, Inc. - Baby Bears for Sale | Purchase Live Baby Bea
- buybears.org
4,869,133
$
240.00
En Yeni Dekor Mobilya Modelleri
- dekormobilyam3.com
Mobilya Dekoratif modellerinin en iyileri
Not Applicable
$
8.95
Wrinkle Miracle - Discover a $5 Solution to a Wrinkle Free Face
- skinimpracticalsympathy.review
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Tue, 10 Dec 2019 15:07:48 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 07 May 2019 12:39:07 GMT
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 54302168efe52832-SJC
Content-Encoding: gzip
Date: Tue, 10 Dec 2019 15:07:48 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 07 May 2019 12:39:07 GMT
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 54302168efe52832-SJC
Content-Encoding: gzip
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
jeff.ns.cloudflare.com | 172.64.33.124 | United States of America | |
laura.ns.cloudflare.com | 173.245.58.183 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
kurort-zu-hause.de | A | 299 |
IP: 104.31.85.83 |
kurort-zu-hause.de | A | 299 |
IP: 104.31.84.83 |
kurort-zu-hause.de | NS | 86400 |
Target: laura.ns.cloudflare.com |
kurort-zu-hause.de | NS | 86400 |
Target: jeff.ns.cloudflare.com |
kurort-zu-hause.de | SOA | 3600 |
MNAME: jeff.ns.cloudflare.com RNAME: dns.cloudflare.com Serial: 2031164723 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600 |
kurort-zu-hause.de | TXT | 300 |
TXT: ca3-945ecbf6305f495d930852a58b211ab2 |
kurort-zu-hause.de | AAAA | 299 |
IPV6: 2606:4700:30::681f:5453 |
kurort-zu-hause.de | AAAA | 299 |
IPV6: 2606:4700:30::681f:5553 |
Full WHOIS Lookup
% Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%
Domain: kurort-zu-hause.de
Nserver: jeff.ns.cloudflare.com
Nserver: laura.ns.cloudflare.com
Status: connect
Changed: 2019-12-09T16:15:17+01:00
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%
Domain: kurort-zu-hause.de
Nserver: jeff.ns.cloudflare.com
Nserver: laura.ns.cloudflare.com
Status: connect
Changed: 2019-12-09T16:15:17+01:00